current location:Home > kelasoperasipangkalandatamysqldalamphp search

Classify:
Found a total of 5687 related content
  • Travel hotel booking car rental service website template
    Travel hotel booking car rental service website template
    One-stop service website template for travel hotel booking and car rental is a travel website template download suitable for providing one-stop service for hotel booking and car rental. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 48 673
  • Internet data SEO service website template
    Internet data SEO service website template
    Internet data SEO service website template is a promotional website template download suitable for Internet companies that provide SEO, data analysis, software development and other services. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 18 778
  • Beauty and skin care SPA industry website template
    Beauty and skin care SPA industry website template
    The beauty and skin care SPA industry website template is a website template download suitable for promotion of the beauty, skin care and medical beauty industry. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 59 548
  • Responsive HTML5 Explore World Travel Website Template
    Responsive HTML5 Explore World Travel Website Template
    The responsive HTML5 Explore the World Travel website template is a downloadable website template suitable for travel industry promotion. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 45 557
  • HTML5 environmental protection and animal protection website template
    HTML5 environmental protection and animal protection website template
    HTML5 environmental protection and animal protection website template is a website template suitable for environmental and animal protection promotion website template download. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 56 625
  • Housekeeping cleaning service company promotional website template
    Housekeeping cleaning service company promotional website template
    Housekeeping and cleaning service company promotional website template is a website template download for a housekeeping and cleaning service company. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 17 451
  • Sports running shoes online mall website template
    Sports running shoes online mall website template
    The sports running shoes online mall website template is an e-commerce website template download that provides online purchase services for various sports running shoes. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 35 351
  • Global IT service company promotional website template
    Global IT service company promotional website template
    Global IT service company promotional website template is a company promotional website template download that provides IT services. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 14 327
  • Modern New Energy Company HTML5 website template
    Modern New Energy Company HTML5 website template
    Modern New Energy Company HTML5 website template is a promotional website template suitable for companies engaged in solar energy, wind energy and other new energy service companies to download. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 22 309
  • Technology style information technology service company website template
    Technology style information technology service company website template
    The technology-style information technology service company website template is a promotional website template download for an information technology service company. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 41 416
  • Bicycle service company promotional website template
    Bicycle service company promotional website template
    Bicycle service company promotional website template is a promotional website template download that provides bicycle promotional purchase services. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 9 295
  • Modern design agency service company website template
    Modern design agency service company website template
    Modern design agency service company website template is a downloadable promotional website template for design service companies that provides user interface design, web design, responsive design and other design services. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 10 304
  • HTML5 web design service company website template
    HTML5 web design service company website template
    HTML5 web design service company website template is a suitable website template download. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 16 331
  • Responsive HTML5 e-book website template
    Responsive HTML5 e-book website template
    The responsive HTML5 e-book website template is a website template download that provides e-book online purchase services. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 37 349
  • Cloud computing domain name hosting service company website template
    Cloud computing domain name hosting service company website template
    Cloud computing domain name hosting service company website template is a domain name hosting service company promotional website template download. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 28 509
  • Blue style property insurance services company website template
    Blue style property insurance services company website template
    The blue style property insurance service company website template is a suitable download for promotional website templates for financial and insurance service companies. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 4 268
  • Responsive business consulting management services website template
    Responsive business consulting management services website template
    The responsive corporate consulting and management service website template is a promotional website template for the corporate consulting and management service industry. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 14 231
  • E-commerce management system service company website template
    E-commerce management system service company website template
    The e-commerce management system service company website template is a downloadable e-commerce management service system company promotional website template. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 13 285
  • HTML5 medical service organization promotion website template
    HTML5 medical service organization promotion website template
    HTML5 medical service institution promotion website template is a downloadable website template suitable for promotion in the medical service industry. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 10 262
  • HTML5 creative agency services website template
    HTML5 creative agency services website template
    HTML5 creative agency service website template is a website template download that provides agency service agency promotion website templates such as web page opening, UI design, UX design, development marketing, etc. Tip: This template calls the Google font library, and the page may open slowly.
    2024-01-17 3 202